PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10039940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 191aa    MW: 20325.9 Da    PI: 7.8247
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10039940genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.75.4e-4517115199
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l++el++++
  Lus10039940  17 PCAACKFLRRKCMPGCIFAPYFPPEEPNKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVHRLQKELDAAN 114
                  7*********************************************************************************************9987 PP

       DUF260  99 e 99 
                  +
  Lus10039940 115 A 115
                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.96616117IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-4417114IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MAASSSSSTS TNSYNSPCAA CKFLRRKCMP GCIFAPYFPP EEPNKFANVH KIFGASNVTK  60
LLNELLPHQR EDAVNSLAYE AEARVRDPVY GCVGAISFLQ RQVHRLQKEL DAANADLIRF  120
ACNGAATTTT LPPVVASRAL VFDDPLITTR RPYVGPNVSG LPSFPYGHDL PWNDDHANNG  180
GGVGGGGGGM *
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004138269.11e-84PREDICTED: protein LATERAL ORGAN BOUNDARIES
SwissprotQ9FML46e-80LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0A0LU811e-84A0A0A0LU81_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s09370.14e-82(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-72LBD family protein